PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_1783B924B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 1043aa    MW: 117601 Da    PI: 6.5203
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_1783B924B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR177.13.5e-24269355190
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fY +YA ++GF+vrk  s+k+  n+ +++r +vCskeg+r ++ ++  + +++raetrtgC+a+++vk +++gk++vt+++ +HnH+
  Traes_5BL_1783B924B.1 269 EFYVSYAGTAGFNVRKGCSEKT-ANNVTKSRAYVCSKEGFRPKSFTA--EPKKQRAETRTGCEAHMTVKITTSGKYVVTECVADHNHD 353
                            6*****************9999.66669*************999877..9999**********************************9 PP

                   FAR1  89 la 90 
                            l 
  Traes_5BL_1783B924B.1 354 LE 355
                            95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.6E-21269355IPR004330FAR1 DNA binding domain
PfamPF105519.6E-24455549IPR018289MULE transposase domain
PfamPF044347.2E-6723767IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096610.076723770IPR007527Zinc finger, SWIM-type
SMARTSM005758.3E-7745772IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 1043 aa     Download sequence    Send to blast
MIMQRFLCCR GNYSYRKGNK AKDSDPAKEV EDGAAGGGEG EGKVEAPKKR GRKPGKKSTP  60
VIEVENSVEK GVAIAGAENG QAVPSTKNLG RGGDKKDVAE KDVESVVELE EEHVEVEDAA  120
QDGAHDLGDG DDAGSDAGEG VMEKEVEVKE KRGRGRPRKA VTEGNALQAC VSTDLGVTAS  180
QCAVDERKKI LNKYLSKRQS RPASGRPAKP LERRSKRLEK QNLQNEKKPE SKEYEIVEAE  240
QDPETEVVAG PGGEPKVGMV FLNEDKAYEF YVSYAGTAGF NVRKGCSEKT ANNVTKSRAY  300
VCSKEGFRPK SFTAEPKKQR AETRTGCEAH MTVKITTSGK YVVTECVADH NHDLEAPVVD  360
IQILRSQKLL AKLQQPPDPP KVVLIPNDYK NYVRTRHTTD MQLGDARAIS EYLQRMKGEN  420
PSFFCSIQVD EDDQFRNVFW ADVKSVMDFN YFGDVVCVDT RYSISDYCRP LLLFIGVNHH  480
KQPTIFGTAF IYDESVESFK WLFETFKSAM SGKQPRTVLT DRSTAISDAV ASAWPGTAHR  540
FSLLHLYQNA TKVLSDTFQG SETFAHDFSR SLYDYEEEGD FLSSWEILLA KYNLKDNEWL  600
SKLYEDRERW ALPYGRDIFC ADIAATLRSD NMDAILTGVL KTEIDLPYFF SRYDKFLEEK  660
RLAEQEADYL GVQMTQRVPP LRLLWQAANT YTPALFELFR LEFELVLACM VYCCGEIGPI  720
SEYEVTVKNR PQVHFVRFDS SEYMVLCSCK KFEFVGLPCC HALKVLEIKN IKELPPQYIL  780
KRWRKDAQSE SPKENFGFAA VGEDPKFTVS KRHNSLYRTL YKVAAKAAEN IEGQRFMESQ  840
YDQLLEQVEL LLQAKLHDKP SLSTIMRSQQ PNLPQNDTSN SEPRRASSKK NKNVENRRQQ  900
QSPLESSKKK KGRQGLVEPE EAELPLRVLA PTISNDIPNH MSTPTNQFLA PSHLMQAPYV  960
TQQFGLNSLQ GFSGMSPFGQ MQEQSPVHLQ QPHLQQPPFH SGPQMHQAPP PDIQSLQFLS  1020
SNPQLGHQTT DQGQYTIPVW DFL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150158KRGRGRPRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3600420.0AK360042.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1108P13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229050.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X5
TrEMBLW5F8080.0W5F808_WHEAT; Uncharacterized protein
STRINGMLOC_17927.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-104FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]